PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013607325.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 502aa    MW: 56031.2 Da    PI: 9.3594
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013607325.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.8e-1769115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ede l +av ++ g++Wk+Ia+ ++  Rt  qc +rwqk+l
   XP_013607325.1  69 KGGWTPQEDETLRQAVDKYKGKRWKKIAEFFP-ERTQVQCLHRWQKVL 115
                      688*****************************.************986 PP

2Myb_DNA-binding605.1e-19121167148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd ++v++vk++G+  W++Ia+ ++ gR +kqc++rw+++l
   XP_013607325.1 121 KGTWTQEEDAIIVELVKKYGPAKWSLIAKSLP-GRIGKQCRERWHNHL 167
                      799*****************************.*************97 PP

3Myb_DNA-binding58.12e-18173216146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WTteE+  l++a +++G++ W+ Ia+ ++ gRt++ +k++w++
   XP_013607325.1 173 KDAWTTEEETALINAQQKHGNK-WAEIAKVLP-GRTDNAIKNHWNS 216
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5364115IPR017930Myb domain
SuperFamilySSF466891.22E-1565122IPR009057Homeodomain-like
SMARTSM007178.1E-1568117IPR001005SANT/Myb domain
PfamPF002492.3E-1569115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2471131IPR009057Homeodomain-like
CDDcd001671.27E-1272115No hitNo description
PROSITE profilePS5129431.981116171IPR017930Myb domain
SuperFamilySSF466898.99E-32118214IPR009057Homeodomain-like
SMARTSM007175.4E-18120169IPR001005SANT/Myb domain
PfamPF002491.2E-17121167IPR001005SANT/Myb domain
CDDcd001672.59E-15123167No hitNo description
Gene3DG3DSA:1.10.10.609.5E-27132174IPR009057Homeodomain-like
PROSITE profilePS5129422.444172222IPR017930Myb domain
SMARTSM007176.4E-17172220IPR001005SANT/Myb domain
PfamPF002493.7E-16173216IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-23175222IPR009057Homeodomain-like
CDDcd001676.29E-13175218No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MKSSGSNPLA FSPAKERSEM KIEILCMENK QPTPASASEG SVNIFLYSPQ LKTPAPAHRR  60
TSGPMRRAKG GWTPQEDETL RQAVDKYKGK RWKKIAEFFP ERTQVQCLHR WQKVLNPELI  120
KGTWTQEEDA IIVELVKKYG PAKWSLIAKS LPGRIGKQCR ERWHNHLNPG IRKDAWTTEE  180
ETALINAQQK HGNKWAEIAK VLPGRTDNAI KNHWNSSLKK KLDFYFATCN LPPSATKLSS  240
ATKPLKDSDS VTQSSSVNID ANEDGVDHVD SSSDMLEESG VNEYACSPVS VECKPQLPNL  300
RPMSPRINSN AFVQKKEENG FGTPRHGNLY YKSPLDSYFA SEADLRRMYG YECGCSPSAV  360
SSSPVSLTIT PPCNKDSGLA AATRSPESFL REAARTFPNT PSIFRKRRKV VLAKKTDDVV  420
NSAVKEADQN ENSKDSAVIS PVGREALLLL ETVDDSNEVL SFNVSPPYRV IAKRRAVFKS  480
RQLEFTSAKE NQPETSEEDK SV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-66682225159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-66682225159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607325.10.0PREDICTED: myb-related protein 3R-1 isoform X2
TrEMBLA0A0D3EIC60.0A0A0D3EIC6_BRAOL; Uncharacterized protein
STRINGBra009597.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.20.0myb domain protein 3r-5